PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0351s0056.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 389aa    MW: 41584 Da    PI: 5.3815
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0351s0056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.11.8e-33186243158
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                          ldDgy+WrKYGqK vk+s+fprsYYrCts++C vkk+vers+ed  +v++tYeg+H+h
  Kalax.0351s0056.1.p 186 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSPSCGVKKRVERSSEDSAIVVTTYEGQHTH 243
                          59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-34171245IPR003657WRKY domain
SuperFamilySSF1182901.57E-28178244IPR003657WRKY domain
PROSITE profilePS5081131.089181246IPR003657WRKY domain
SMARTSM007746.4E-40186245IPR003657WRKY domain
PfamPF031061.8E-26187243IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MDGAEDQTAT IDSLLMMSPS FPDQIPASSF SLSGLFDMPP LAASAAPPSA SYSYDIDKIG  60
EGGFLGFSDL LGFQDYCYGA SFFDLIQTSP PLQAVTTTVP SPASTVPETS EVLNGPMTPN  120
SSSNEAAAAA NEEQSEECQG VNGGNTEQED QDRDKTKNQL RPKKKNQKKE KEPRFAFMTK  180
SETDHLDDGY RWRKYGQKAV KNSPFPRSYY RCTSPSCGVK KRVERSSEDS AIVVTTYEGQ  240
HTHLSPVMAR GSGITGSLLH HHLDSISSSS CSVQLGVSSL APPPSFPTPS PSSFLNNNAT  300
ANMVSSLSSF INNNPSPPSN HASPSLGPNP FFKERRFRPS PPAAAGHHPP PTSQHITTAP  360
AAAGSSSCLM RDDGLLQDMI MPSDPKEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-261792461077Probable WRKY transcription factor 4
1wj2_A8e-261792461077Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.14e-39WRKY DNA-binding protein 23